| Name | ABCB11 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6715 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ABCB11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRGSYQDSLRASIRQRSKSQLSYLVHEPPLAVVDHKSTYEEDRKDKDIPV |
| Purity/Format | Affinity purified |
| Blocking Peptide | ABCB11 Blocking Peptide |
| Description | Rabbit polyclonal ABCB11 antibody |
| Gene | ABCB11 |
| Supplier Page | Shop |