Ectodysplasin A antibody

Name Ectodysplasin A antibody
Supplier Fitzgerald
Catalog 70R-5969
Prices $375.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen Ectodysplasin A antibody was raised using the middle region of EDA corresponding to a region with amino acids HLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTY
Purity/Format Affinity purified
Blocking Peptide Ectodysplasin A Blocking Peptide
Description Rabbit polyclonal Ectodysplasin A antibody raised against the middle region of EDA
Gene EDA
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.