Name | Ectodysplasin A antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5969 |
Prices | $375.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | Ectodysplasin A antibody was raised using the middle region of EDA corresponding to a region with amino acids HLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTY |
Purity/Format | Affinity purified |
Blocking Peptide | Ectodysplasin A Blocking Peptide |
Description | Rabbit polyclonal Ectodysplasin A antibody raised against the middle region of EDA |
Gene | EDA |
Supplier Page | Shop |