| Name | CHERP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5262 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | CHERP antibody was raised using the middle region of CHERP corresponding to a region with amino acids SERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRARRRKGQEKR |
| Purity/Format | Affinity purified |
| Blocking Peptide | CHERP Blocking Peptide |
| Description | Rabbit polyclonal CHERP antibody raised against the middle region of CHERP |
| Gene | CHERP |
| Supplier Page | Shop |