| Name | RRAGD antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3629 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RRAGD antibody was raised using the middle region of RRAGD corresponding to a region with amino acids CDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFL |
| Purity/Format | Affinity purified |
| Blocking Peptide | RRAGD Blocking Peptide |
| Description | Rabbit polyclonal RRAGD antibody raised against the middle region of RRAGD |
| Gene | RRAGD |
| Supplier Page | Shop |