Name | EIF2C3 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2539 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | EIF2C3 antibody was raised using the N terminal of EIF2C3 corresponding to a region with amino acids MCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCN |
Purity/Format | Affinity purified |
Blocking Peptide | EIF2C3 Blocking Peptide |
Description | Rabbit polyclonal EIF2C3 antibody raised against the N terminal of EIF2C3 |
Gene | AGO3 |
Supplier Page | Shop |