| Name | HSD17B11 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4589 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | HSD17B11 antibody was raised using a synthetic peptide corresponding to a region with amino acids TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG |
| Purity/Format | Affinity purified |
| Blocking Peptide | HSD17B11 Blocking Peptide |
| Description | Rabbit polyclonal HSD17B11 antibody |
| Gene | SDR16C5 |
| Supplier Page | Shop |