| Name | CACNA1I antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5133 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | CACNA1I antibody was raised using the middle region of CACNA1I corresponding to a region with amino acids LRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAS |
| Purity/Format | Affinity purified |
| Blocking Peptide | CACNA1I Blocking Peptide |
| Description | Rabbit polyclonal CACNA1I antibody raised against the middle region of CACNA1I |
| Gene | CACNA1I |
| Supplier Page | Shop |