| Name | FAM119A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3148 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | FAM119A antibody was raised using the middle region of FAM119A corresponding to a region with amino acids LGAGTGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVVK |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM119A Blocking Peptide |
| Description | Rabbit polyclonal FAM119A antibody raised against the middle region of FAM119A |
| Gene | METTL21A |
| Supplier Page | Shop |