| Name | MAK antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2672 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | MAK antibody was raised using the C terminal of MAK corresponding to a region with amino acids WNTKTGRGQFSGRTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR |
| Purity/Format | Affinity purified |
| Blocking Peptide | MAK Blocking Peptide |
| Description | Rabbit polyclonal MAK antibody raised against the C terminal of MAK |
| Gene | MAK |
| Supplier Page | Shop |