| Name | PEBP1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1036 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | PEBP1 antibody was raised using the C terminal of PEBP1 corresponding to a region with amino acids LSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | PEBP1 Blocking Peptide |
| Description | Rabbit polyclonal PEBP1 antibody raised against the C terminal of PEBP1 |
| Gene | PEBP1 |
| Supplier Page | Shop |