B3GNT7 antibody

Name B3GNT7 antibody
Supplier Fitzgerald
Catalog 70R-7459
Prices $375.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen B3GNT7 antibody was raised using the N terminal of B3GNT7 corresponding to a region with amino acids QFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGR
Purity/Format Affinity purified
Blocking Peptide B3GNT7 Blocking Peptide
Description Rabbit polyclonal B3GNT7 antibody raised against the N terminal of B3GNT7
Gene B3GNT2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.