| Name | MCM6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1614 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Dog |
| Antigen | MCM6 antibody was raised using the C terminal of MCM6 corresponding to a region with amino acids RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | MCM6 Blocking Peptide |
| Description | Rabbit polyclonal MCM6 antibody raised against the C terminal of MCM6 |
| Gene | MCM6 |
| Supplier Page | Shop |