| Name | KCNQ1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5042 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | KCNQ1 antibody was raised using the N terminal of KCNQ1 corresponding to a region with amino acids RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI |
| Purity/Format | Affinity purified |
| Blocking Peptide | KCNQ1 Blocking Peptide |
| Description | Rabbit polyclonal KCNQ1 antibody raised against the N terminal of KCNQ1 |
| Gene | KCNQ1 |
| Supplier Page | Shop |