| Name | MYLIP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2736 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | MYLIP antibody was raised using the middle region of MYLIP corresponding to a region with amino acids CSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCE |
| Purity/Format | Affinity purified |
| Blocking Peptide | MYLIP Blocking Peptide |
| Description | Rabbit polyclonal MYLIP antibody raised against the middle region of MYLIP |
| Gene | MYLIP |
| Supplier Page | Shop |