IZUMO1 antibody

Name IZUMO1 antibody
Supplier Fitzgerald
Catalog 70R-7523
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen IZUMO1 antibody was raised using the C terminal of IZUMO1 corresponding to a region with amino acids SLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPKEKATDSRQQ
Purity/Format Affinity purified
Blocking Peptide IZUMO1 Blocking Peptide
Description Rabbit polyclonal IZUMO1 antibody raised against the C terminal of IZUMO1
Gene IZUMO1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.