| Name | TXNIP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2031 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TXNIP antibody was raised using the C terminal of TXNIP corresponding to a region with amino acids DTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAPEFKFMPP |
| Purity/Format | Affinity purified |
| Blocking Peptide | TXNIP Blocking Peptide |
| Description | Rabbit polyclonal TXNIP antibody raised against the C terminal of TXNIP |
| Gene | TXNIP |
| Supplier Page | Shop |