ZNF294 antibody

Name ZNF294 antibody
Supplier Fitzgerald
Catalog 70R-2768
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ZNF294 antibody was raised using the N terminal of ZNF294 corresponding to a region with amino acids MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPA
Purity/Format Affinity purified
Blocking Peptide ZNF294 Blocking Peptide
Description Rabbit polyclonal ZNF294 antibody raised against the N terminal of ZNF294
Gene LTN1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.