| Name | GFRA2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5332 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | GFRA2 antibody was raised using the C terminal of GFRA2 corresponding to a region with amino acids NVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLK |
| Purity/Format | Affinity purified |
| Blocking Peptide | GFRA2 Blocking Peptide |
| Description | Rabbit polyclonal GFRA2 antibody raised against the C terminal of GFRA2 |
| Gene | GFRA2 |
| Supplier Page | Shop |