HERC5 antibody

Name HERC5 antibody
Supplier Fitzgerald
Catalog 70R-5524
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen HERC5 antibody was raised using the N terminal of HERC5 corresponding to a region with amino acids CLVAELVGYRVTQIACGRWHTLAYVSDLGKVFSFGSGKDGQLGNGGTRDQ
Purity/Format Affinity purified
Blocking Peptide HERC5 Blocking Peptide
Description Rabbit polyclonal HERC5 antibody raised against the N terminal of HERC5
Gene HERC5
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.