| Name | FBXL7 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1164 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | FBXL7 antibody was raised using the N terminal of FBXL7 corresponding to a region with amino acids IRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWD |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | FBXL7 Blocking Peptide |
| Description | Rabbit polyclonal FBXL7 antibody raised against the N terminal of FBXL7 |
| Gene | KDM2A |
| Supplier Page | Shop |