FBXL7 antibody

Name FBXL7 antibody
Supplier Fitzgerald
Catalog 70R-1164
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human, Mouse, Rat
Antigen FBXL7 antibody was raised using the N terminal of FBXL7 corresponding to a region with amino acids IRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWD
Purity/Format Total IgG Protein A purified
Blocking Peptide FBXL7 Blocking Peptide
Description Rabbit polyclonal FBXL7 antibody raised against the N terminal of FBXL7
Gene KDM2A
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.