| Name | NCAPD2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5556 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | NCAPD2 antibody was raised using the C terminal of NCAPD2 corresponding to a region with amino acids KAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSTGSRYQPL |
| Purity/Format | Affinity purified |
| Blocking Peptide | NCAPD2 Blocking Peptide |
| Description | Rabbit polyclonal NCAPD2 antibody raised against the C terminal of NCAPD2 |
| Gene | NCAPD2 |
| Supplier Page | Shop |