RNF153 antibody

Name RNF153 antibody
Supplier Fitzgerald
Catalog 70R-6496
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen RNF153 antibody was raised using a synthetic peptide corresponding to a region with amino acids CRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVY
Purity/Format Affinity purified
Blocking Peptide RNF153 Blocking Peptide
Description Rabbit polyclonal RNF153 antibody
Gene MARCH5
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.