| Name | SMUG1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2095 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | SMUG1 antibody was raised using the middle region of SMUG1 corresponding to a region with amino acids IVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHC |
| Purity/Format | Affinity purified |
| Blocking Peptide | SMUG1 Blocking Peptide |
| Description | Rabbit polyclonal SMUG1 antibody raised against the middle region of SMUG1 |
| Gene | SMUG1 |
| Supplier Page | Shop |