Name | DNASE2B antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1554 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | DNASE2B antibody was raised using the C terminal of DNASE2B corresponding to a region with amino acids MAQRLKTHLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFSSYQD |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | DNASE2B Blocking Peptide |
Description | Rabbit polyclonal DNASE2B antibody raised against the C terminal of DNASE2B |
Gene | DNASE2B |
Supplier Page | Shop |