DNASE2B antibody

Name DNASE2B antibody
Supplier Fitzgerald
Catalog 70R-1554
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen DNASE2B antibody was raised using the C terminal of DNASE2B corresponding to a region with amino acids MAQRLKTHLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFSSYQD
Purity/Format Total IgG Protein A purified
Blocking Peptide DNASE2B Blocking Peptide
Description Rabbit polyclonal DNASE2B antibody raised against the C terminal of DNASE2B
Gene DNASE2B
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.