| Name | NCF4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5753 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | NCF4 antibody was raised using the middle region of NCF4 corresponding to a region with amino acids TGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKSVAWEGGACPAF |
| Purity/Format | Affinity purified |
| Blocking Peptide | NCF4 Blocking Peptide |
| Description | Rabbit polyclonal NCF4 antibody raised against the middle region of NCF4 |
| Gene | NCF4 |
| Supplier Page | Shop |