| Name | SUSD4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6885 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SUSD4 antibody was raised using the middle region of SUSD4 corresponding to a region with amino acids HGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQV |
| Purity/Format | Affinity purified |
| Blocking Peptide | SUSD4 Blocking Peptide |
| Description | Rabbit polyclonal SUSD4 antibody raised against the middle region of SUSD4 |
| Gene | SUSD4 |
| Supplier Page | Shop |