NEK11 antibody

Name NEK11 antibody
Supplier Fitzgerald
Catalog 70R-2292
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen NEK11 antibody was raised using a synthetic peptide corresponding to a region with amino acids KEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMS
Purity/Format Affinity purified
Blocking Peptide NEK11 Blocking Peptide
Description Rabbit polyclonal NEK11 antibody
Gene NEK11
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.