| Name | ADAR antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5881 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ADAR antibody was raised using the N terminal of ADAR corresponding to a region with amino acids GEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVS |
| Purity/Format | Affinity purified |
| Blocking Peptide | ADAR Blocking Peptide |
| Description | Rabbit polyclonal ADAR antibody raised against the N terminal of ADAR |
| Gene | ADAR |
| Supplier Page | Shop |