| Name | CK1 epsilon antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2068 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Drosophila |
| Antigen | CK1 epsilon antibody was raised using the N terminal of CSNK1E corresponding to a region with amino acids MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH |
| Purity/Format | Affinity purified |
| Blocking Peptide | CK1 epsilon Blocking Peptide |
| Description | Rabbit polyclonal CK1 epsilon antibody raised against the N terminal of CSNK1E |
| Gene | KRT1 |
| Supplier Page | Shop |