| Name | RAP1B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2677 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Drosophila |
| Antigen | RAP1B antibody was raised using the N terminal of RAP1B corresponding to a region with amino acids MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | RAP1B Blocking Peptide |
| Description | Rabbit polyclonal RAP1B antibody raised against the N terminal of RAP1B |
| Gene | RABGEF1 |
| Supplier Page | Shop |