| Name | C17ORF81 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3959 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C17ORF81 antibody was raised using the C terminal Of C17Orf81 corresponding to a region with amino acids FSILPDFSLDLQEGPSVESQPYSDPHIPPVSKNAKARTRKCSLVSGHGRE |
| Purity/Format | Affinity purified |
| Blocking Peptide | C17ORF81 Blocking Peptide |
| Description | Rabbit polyclonal C17ORF81 antibody raised against the C terminal Of C17Orf81 |
| Gene | ELP5 |
| Supplier Page | Shop |