| Name | SERBP1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4695 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SERBP1 antibody was raised using the C terminal of SERBP1 corresponding to a region with amino acids DRAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPAN |
| Purity/Format | Affinity purified |
| Blocking Peptide | SERBP1 Blocking Peptide |
| Description | Rabbit polyclonal SERBP1 antibody raised against the C terminal of SERBP1 |
| Gene | SERBP1 |
| Supplier Page | Shop |