| Name | RBM4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4823 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RBM4 antibody was raised using the middle region of RBM4 corresponding to a region with amino acids TAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPY |
| Purity/Format | Affinity purified |
| Blocking Peptide | RBM4 Blocking Peptide |
| Description | Rabbit polyclonal RBM4 antibody raised against the middle region of RBM4 |
| Gene | RBM4 |
| Supplier Page | Shop |