Name | SHROOM2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5079 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | SHROOM2 antibody was raised using the middle region of SHROOM2 corresponding to a region with amino acids CTSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTM |
Purity/Format | Affinity purified |
Blocking Peptide | SHROOM2 Blocking Peptide |
Description | Rabbit polyclonal SHROOM2 antibody raised against the middle region of SHROOM2 |
Gene | SHROOM2 |
Supplier Page | Shop |