| Name | Myosin Ie antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2901 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Myosin Ie antibody was raised using the middle region of MYO1E corresponding to a region with amino acids PKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGR |
| Purity/Format | Affinity purified |
| Blocking Peptide | Myosin Ie Blocking Peptide |
| Description | Rabbit polyclonal Myosin Ie antibody raised against the middle region of MYO1E |
| Gene | MYO1E |
| Supplier Page | Shop |