| Name | COMT antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7143 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | COMT antibody was raised using the middle region of COMT corresponding to a region with amino acids PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH |
| Purity/Format | Affinity purified |
| Blocking Peptide | COMT Blocking Peptide |
| Description | Rabbit polyclonal COMT antibody raised against the middle region of COMT |
| Gene | COMT |
| Supplier Page | Shop |