SLC7A2 antibody

Name SLC7A2 antibody
Supplier Fitzgerald
Catalog 70R-6789
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SLC7A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATC
Purity/Format Affinity purified
Blocking Peptide SLC7A2 Blocking Peptide
Description Rabbit polyclonal SLC7A2 antibody
Gene SLC7A2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.