NASP antibody

Name NASP antibody
Supplier Fitzgerald
Catalog 70R-2036
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen NASP antibody was raised using a synthetic peptide corresponding to a region with amino acids KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV
Purity/Format Affinity purified
Blocking Peptide NASP Blocking Peptide
Description Rabbit polyclonal NASP antibody
Gene NASP
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.