| Name | TRIM72 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2773 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | TRIM72 antibody was raised using the N terminal of TRIM72 corresponding to a region with amino acids CASLGSHRGHRLLPAAEAHARLKTQLPQQKLQLQEACMRKEKSVAVLEHQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | TRIM72 Blocking Peptide |
| Description | Rabbit polyclonal TRIM72 antibody raised against the N terminal of TRIM72 |
| Gene | TRIM72 |
| Supplier Page | Shop |