| Name | LCAT antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7207 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | LCAT antibody was raised using the C terminal of LCAT corresponding to a region with amino acids GVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTL |
| Purity/Format | Affinity purified |
| Blocking Peptide | LCAT Blocking Peptide |
| Description | Rabbit polyclonal LCAT antibody raised against the C terminal of LCAT |
| Gene | LCAT |
| Supplier Page | Shop |