LCAT antibody

Name LCAT antibody
Supplier Fitzgerald
Catalog 70R-7207
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen LCAT antibody was raised using the C terminal of LCAT corresponding to a region with amino acids GVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTL
Purity/Format Affinity purified
Blocking Peptide LCAT Blocking Peptide
Description Rabbit polyclonal LCAT antibody raised against the C terminal of LCAT
Gene LCAT
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.