| Name | TRPC6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5175 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TRPC6 antibody was raised using the N terminal of TRPC6 corresponding to a region with amino acids MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPC |
| Purity/Format | Affinity purified |
| Blocking Peptide | TRPC6 Blocking Peptide |
| Description | Rabbit polyclonal TRPC6 antibody raised against the N terminal of TRPC6 |
| Gene | TRPC6 |
| Supplier Page | Shop |