SEMA4F antibody

Name SEMA4F antibody
Supplier Fitzgerald
Catalog 70R-6853
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen SEMA4F antibody was raised using the N terminal of SEMA4F corresponding to a region with amino acids PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL
Purity/Format Affinity purified
Blocking Peptide SEMA4F Blocking Peptide
Description Rabbit polyclonal SEMA4F antibody raised against N terminal of SEMA4F
Gene SEMA4F
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.