| Name | SEMA4F antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6853 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SEMA4F antibody was raised using the N terminal of SEMA4F corresponding to a region with amino acids PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL |
| Purity/Format | Affinity purified |
| Blocking Peptide | SEMA4F Blocking Peptide |
| Description | Rabbit polyclonal SEMA4F antibody raised against N terminal of SEMA4F |
| Gene | SEMA4F |
| Supplier Page | Shop |