RAD51AP1 antibody

Name RAD51AP1 antibody
Supplier Fitzgerald
Catalog 70R-4860
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen RAD51AP1 antibody was raised using the middle region of RAD51AP1 corresponding to a region with amino acids EDDVGGVQGKRKAASKAAAQQRKILLEGSDGDSANDTEPDFAPGEDSEDD
Purity/Format Affinity purified
Blocking Peptide RAD51AP1 Blocking Peptide
Description Rabbit polyclonal RAD51AP1 antibody raised against the middle region of RAD51AP1
Gene RAD51AP1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.