| Name | LRRC8B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6538 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | LRRC8B antibody was raised using the middle region of LRRC8B corresponding to a region with amino acids TLYLKSSLSRIPQVVTDLLPSLQKLSLDNEGSKLVVLNNLKKMVNLKSLE |
| Purity/Format | Affinity purified |
| Blocking Peptide | LRRC8B Blocking Peptide |
| Description | Rabbit polyclonal LRRC8B antibody raised against the middle region of LRRC8B |
| Gene | LRRC8B |
| Supplier Page | Shop |