| Name | POFUT2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1592 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | POFUT2 antibody was raised using the C terminal of POFUT2 corresponding to a region with amino acids RFEPTWEELELYKDGGVAIIDQWICAHARCLPTSLSAESGSGGFQRFFCP |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | POFUT2 Blocking Peptide |
| Description | Rabbit polyclonal POFUT2 antibody raised against the C terminal of POFUT2 |
| Gene | POFUT2 |
| Supplier Page | Shop |