Name | SMCR7L antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6378 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | SMCR7L antibody was raised using the N terminal of SMCR7L corresponding to a region with amino acids GAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRSWEEPNWMGSPRLLN |
Purity/Format | Affinity purified |
Blocking Peptide | SMCR7L Blocking Peptide |
Description | Rabbit polyclonal SMCR7L antibody raised against the N terminal of SMCR7L |
Gene | MIEF1 |
Supplier Page | Shop |