| Name | SMCR7L antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6378 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SMCR7L antibody was raised using the N terminal of SMCR7L corresponding to a region with amino acids GAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRSWEEPNWMGSPRLLN |
| Purity/Format | Affinity purified |
| Blocking Peptide | SMCR7L Blocking Peptide |
| Description | Rabbit polyclonal SMCR7L antibody raised against the N terminal of SMCR7L |
| Gene | MIEF1 |
| Supplier Page | Shop |