| Name | C20ORF24 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1817 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | C20ORF24 antibody was raised using the N terminal Of C20Orf24 corresponding to a region with amino acids MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEFLDVIYWFRQ |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | C20ORF24 Blocking Peptide |
| Description | Rabbit polyclonal C20ORF24 antibody raised against the N terminal Of C20Orf24 |
| Gene | DSTYK |
| Supplier Page | Shop |