METAP1 antibody

Name METAP1 antibody
Supplier Fitzgerald
Catalog 70R-2201
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen METAP1 antibody was raised using the N terminal of METAP1 corresponding to a region with amino acids GDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQ
Purity/Format Affinity purified
Blocking Peptide METAP1 Blocking Peptide
Description Rabbit polyclonal METAP1 antibody raised against the N terminal of METAP1
Gene METAP1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.