NEURL2 antibody

Name NEURL2 antibody
Supplier Fitzgerald
Catalog 70R-5854
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen NEURL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAAASEPVDSGALWGLERPEPPPTRFHRVHGANIRVDPSGTRATRVESFA
Purity/Format Affinity purified
Blocking Peptide NEURL2 Blocking Peptide
Description Rabbit polyclonal NEURL2 antibody
Gene NEURL2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.